DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and ceh-36

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_510365.1 Gene:ceh-36 / 181529 WormBaseID:WBGene00000457 Length:257 Species:Caenorhabditis elegans


Alignment Length:147 Identity:55/147 - (37%)
Similarity:78/147 - (53%) Gaps:35/147 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 RKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQ---VWFKNRRAKCRQQL 126
            |..|||||:|.|.|||.||.:|.:|:|||:..||.:|..||||:.|||   |||||||||.|   
 Worm    53 RAGRRERTSFNRGQLDQLEKVFRETQYPDVHRREALAKAINLPDGRVQVITVWFKNRRAKDR--- 114

  Fly   127 QQQQQSNSLSSSKNASGGGSGNSCSSSSANSRSNSNNNGSSSNNNTQSSGGN-------NSNKSS 184
                      ::|...|...|      |.:|||::.:..:.|..:|:|.|.:       |::.::
 Worm   115 ----------NNKKMDGVHPG------STSSRSSNGSPHNESKPDTKSLGIHIPGTPEFNAHSAA 163

  Fly   185 QKQGNS------QSSQQ 195
            :.:.||      |..||
 Worm   164 KYEANSAVLSQLQQQQQ 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 33/54 (61%)
ceh-36NP_510365.1 Homeobox 59..115 CDD:395001 34/68 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167891
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2251
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I3466
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.840

Return to query results.
Submit another query.