DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and ttx-1

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001024212.1 Gene:ttx-1 / 180313 WormBaseID:WBGene00006652 Length:391 Species:Caenorhabditis elegans


Alignment Length:274 Identity:94/274 - (34%)
Similarity:124/274 - (45%) Gaps:61/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HPHSYGGPHPHHSVPHGPLPPGMPMPS---------LGPFGLPHGLEAVGFSQGMWGVN----TR 65
            :|.|:.| .|.:...|..|...|.:||         :|...              |..|    :|
 Worm   148 YPTSHLG-FPSNVGSHSFLQSNMYIPSSLSDCPTATMGSMS--------------WNANQPGFSR 197

  Fly    66 KQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQQ 130
            |||||||||||.||::||:.|.|||||||||||::|.||.||||||||||||||||.|||.:...
 Worm   198 KQRRERTTFTRNQLEILESYFVKTRYPDIFMREDMAHKIQLPESRVQVWFKNRRAKARQQKKTLA 262

  Fly   131 QSNS---LSSSKNASGGGSGNSCSSSSANSRSNSNNNGSSSNNNTQSSGGNNSNKSSQKQGNSQS 192
            .|||   .|.:..::||||.|..:.|.....|     .:::::..:.|.........|....|..
 Worm   263 PSNSGVTCSGNNGSTGGGSSNGSTGSEVQPSS-----PATTDSELKFSEVIKEECDEQSISPSAD 322

  Fly   193 SQQGG-------GSSGGNNSNNNSAAAAASAAAAVAAAQSIKTHHSSFLSAAAAAASGGTNQSAN 250
            .|:|.       .||.|..|.|.:::....|....|:..:....:|                .:|
 Worm   323 DQKGVNSYINPISSSSGTTSYNGTSSFRPQAQYPYASYPAYDFQYS----------------QSN 371

  Fly   251 NNSNNNN--QGNST 262
            .||.|..  .||||
 Worm   372 TNSTNTYTLDGNST 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 41/51 (80%)
ttx-1NP_001024212.1 Homeobox 203..256 CDD:365835 41/52 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167890
Domainoid 1 1.000 96 1.000 Domainoid score I4616
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - oto20667
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45793
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3028
SonicParanoid 1 1.000 - - X850
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.