DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and VAX1

DIOPT Version :9

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001106175.1 Gene:VAX1 / 11023 HGNCID:12660 Length:334 Species:Homo sapiens


Alignment Length:291 Identity:78/291 - (26%)
Similarity:112/291 - (38%) Gaps:94/291 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQ 125
            |::..:.:|.||:||..||..||..|.:.:|.....|.|:|.::||.|::|:|||:|||.|   |
Human    94 GLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTK---Q 155

  Fly   126 LQQQQQSNSLSS--SKNASGGGSGNSCSSSSANSRSNSNNNGSSSNNNTQSSGGNNSNKSSQKQG 188
            .:.|.:.:.|.|  |:.|:      :||....                             .:||
Human   156 KKDQGKDSELRSVVSETAA------TCSVLRL-----------------------------LEQG 185

  Fly   189 NSQS-------------SQQGGGSSGGNNSNNNSAAAAASAAAAVAAAQSIKTHHSSFLSAAAAA 240
            ...|             ...|....|.:.....:.|||.|||||.|||..         .|.||:
Human   186 RLLSPPGLPALLPPCATGALGSALRGPSLPALGAGAAAGSAAAAAAAAPG---------PAGAAS 241

  Fly   241 ----ASGGTNQSANNNSNNNNQGNSTPNSSSSGGGG---GSQAGGH-LSAAAAAAALNVTAAHQN 297
                |.||                 .|....:|.||   |:.|.|| |.:....:.|...|:..:
Human   242 PHPPAVGG-----------------APGPGPAGPGGLHAGAPAAGHSLFSLPVPSLLGSVASRLS 289

  Fly   298 SSPLLPTPATSVSPVSIVCKKEHLSGGYGSS 328
            |:||  |.|.|::.     ..:.||..|.||
Human   290 SAPL--TMAGSLAG-----NLQELSARYLSS 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeobox 71..123 CDD:333795 24/51 (47%)
VAX1NP_001106175.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
COG5576 66..184 CDD:227863 34/127 (27%)
Homeobox 103..157 CDD:365835 25/56 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..263 10/54 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 314..334 78/291 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I5194
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.