DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and rax2

DIOPT Version :10

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_002941436.1 Gene:rax2 / 100494721 XenbaseID:XB-GENE-494483 Length:227 Species:Xenopus tropicalis


Alignment Length:89 Identity:44/89 - (49%)
Similarity:59/89 - (66%) Gaps:8/89 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 RKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQ 129
            :|.||.|||||..||..||..|.::.|||::.|||:|:|::|||.||||||:|||||.|:|.:.:
 Frog    34 KKHRRNRTTFTTYQLHELERAFERSHYPDVYSREELAMKVSLPEVRVQVWFQNRRAKWRRQEKLE 98

  Fly   130 QQSN--------SLSSSKNASGGG 145
            ..|:        |.|.|..|:|.|
 Frog    99 TSSSKLHDSPLLSFSRSPMATGVG 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeodomain 68..123 CDD:459649 34/54 (63%)
rax2XP_002941436.1 Homeodomain 37..93 CDD:459649 34/55 (62%)
OAR 200..216 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.