DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and shox

DIOPT Version :10

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_004911874.1 Gene:shox / 100486480 XenbaseID:XB-GENE-920752 Length:334 Species:Xenopus tropicalis


Alignment Length:87 Identity:44/87 - (50%)
Similarity:54/87 - (62%) Gaps:12/87 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQ 125
            |....||||.||.||..||:.||.||.:|.|||.|||||::.::.|.|:||||||:|||||||:|
 Frog   150 GQTKLKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQ 214

  Fly   126 LQQQQQSNSLSSSKNASGGGSG 147
            ..|..:            ||.|
 Frog   215 ENQMHK------------GGYG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeodomain 68..123 CDD:459649 34/54 (63%)
shoxXP_004911874.1 Homeodomain 157..213 CDD:459649 35/55 (64%)
OAR 314..330 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.