DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment oc and arxb

DIOPT Version :10

Sequence 1:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster
Sequence 2:XP_002667096.1 Gene:arxb / 100329907 ZFINID:ZDB-GENE-121109-2 Length:385 Species:Danio rerio


Alignment Length:96 Identity:46/96 - (47%)
Similarity:65/96 - (67%) Gaps:0/96 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GVNTRKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQ 125
            |:..|||||.|||||..||:.||..|.||.|||:|.|||:|::::|.|:||||||:|||||.|::
Zfish   156 GMLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKR 220

  Fly   126 LQQQQQSNSLSSSKNASGGGSGNSCSSSSAN 156
            .:...|.::||...:.:...:.:.|...|.|
Zfish   221 EKVGVQPHTLSLHYSGAPPAAQSLCHYLSGN 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ocNP_001356934.1 Homeodomain 68..123 CDD:459649 35/54 (65%)
arxbXP_002667096.1 Homeodomain 163..219 CDD:459649 35/55 (64%)
OAR 351..369 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.