DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32413 and YFR018C

DIOPT Version :9

Sequence 1:NP_001097521.3 Gene:CG32413 / 318018 FlyBaseID:FBgn0052413 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_116673.1 Gene:YFR018C / 850573 SGDID:S000001914 Length:363 Species:Saccharomyces cerevisiae


Alignment Length:320 Identity:84/320 - (26%)
Similarity:126/320 - (39%) Gaps:68/320 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FNATLAKLLKP----RSVGSKGHAEVQDFIETELKRLDFITLKNDF--------QQGVNITNLVG 91
            :|.:...||.|    |..||:|..|:|.||......    ||..::        :.|....|||.
Yeast    51 WNKSTKNLLLPFNRTRVPGSEGSREIQRFIIEHFNN----TLAGEWAVETQAFEENGYRFNNLVM 111

  Fly    92 FWNMRAKFYLMLTCHYDSKKPENVTTDEFLAAAEGAVSCAILLNVAKTLRQFLI-----DRWSE- 150
            .....|..||:|..|||:|    :.....:.|.:.|.|||.||..|    |||.     :|..| 
Yeast   112 TLQNNASEYLVLAAHYDTK----IAPTGMVGAIDSAASCAALLYTA----QFLTHIACHERTKEY 168

  Fly   151 ----------KKSVGLAFIFFDGHNSLSS-DPYDE---NELLGATHFIDEEFIPLRDMAVAVTLS 201
                      ..::|:..:||||..::.. .|.|.   ...|.|....|.....:|   :...|.
Yeast   169 NDLESNTVVSNSTLGVKIVFFDGEEAIEEWGPEDSIYGARRLAAQWLADGTMTRIR---LLFLLD 230

  Fly   202 YIGAPNQTFL--SFFEVTNDLHNLIADIEQDL--RKSGELDD-----CHVLFQKKTHYDKD---- 253
            .:|:..:..|  |::..|:..:.|:..||.||  |:..|::.     ..|..|:| |.|..    
Yeast   231 LLGSGEEEPLVPSYYAETHQEYQLLNRIEDDLLFRRGDEINGESALAAEVARQRK-HLDPTDYRF 294

  Fly   254 -------LLDDHIVFDEQDVPVIHVSPHEFPNVLYTPADNVENLHYPTIRNMIKIIRCFV 306
                   :.|||..|....|||:|..|..||:..:|..|:..:|.....|:...::..||
Yeast   295 LGLGHSVIGDDHTPFLAAGVPVLHAIPLPFPSTWHTVDDDFRHLDAAETRHWALLVCEFV 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32413NP_001097521.3 M28_QC_like 19..309 CDD:349876 84/320 (26%)
YFR018CNP_116673.1 M28_QC_like 36..356 CDD:349876 84/320 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343056
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.