DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32413 and Qpctl

DIOPT Version :9

Sequence 1:NP_001097521.3 Gene:CG32413 / 318018 FlyBaseID:FBgn0052413 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_080387.2 Gene:Qpctl / 67369 MGIID:1914619 Length:383 Species:Mus musculus


Alignment Length:297 Identity:89/297 - (29%)
Similarity:135/297 - (45%) Gaps:27/297 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DDEEHFNATLAKLLKPRSVGSKGHAEVQDFIETELK--------RLDFITLKNDFQQGVNITNLV 90
            |.:..:...|..||..|..||.|:.:|:.|:|..|:        .||..|....... ::..|:|
Mouse    90 DPQRLWGTFLRPLLIVRPPGSSGNLQVRKFLEATLQSLSAGWHVELDPFTASTPLGP-LDFGNVV 153

  Fly    91 GFWNMRAKFYLMLTCHYDSK-KPENVTTDEFLAAAEGAVSCAILLNVAKTLRQFLIDRWSEKKSV 154
            ...:..|..:|.|.|||||| .|..:  ..|:.|.:.||.||:||.:.:.|...|.....:...|
Mouse   154 ATLDPGAARHLTLACHYDSKFFPPGL--PPFVGATDSAVPCALLLELVQALDAMLSRIKQQAAPV 216

  Fly   155 GLAFIFFDGHNSLSS-DPYDENELLGATHFID-EEFIP-------LRDMAVAVTLSYIGAPNQTF 210
            .|..:|.||..:|.. .|.|  .|.|:.|... .|.||       ::.:.:.|.|..:||.:..|
Mouse   217 TLQLLFLDGEEALKEWGPKD--SLYGSRHLAQIMESIPHSPGPTRIQAIELFVLLDLLGASSPIF 279

  Fly   211 LSFFEVTNDLHNLIADIEQDLRKSGELDDCH---VLFQKKTHYDKDLLDDHIVFDEQDVPVIHVS 272
            .|.|..|......:..||:.|.:...|.. |   |::.:.......:.||||.|..:.|||:|:.
Mouse   280 FSHFPRTARWFQRLRSIEKRLHRLNLLQS-HPQEVMYFQPGEPPGPVEDDHIPFLRRGVPVLHLI 343

  Fly   273 PHEFPNVLYTPADNVENLHYPTIRNMIKIIRCFVHDF 309
            ...||.|.:||||...|||.||:.|:.:|:..|:.::
Mouse   344 ATPFPAVWHTPADTEANLHPPTVHNLSRILAVFLAEY 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32413NP_001097521.3 M28_QC_like 19..309 CDD:349876 89/295 (30%)
QpctlNP_080387.2 M28_QC_like 80..380 CDD:193501 89/295 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834726
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.