DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32413 and qpctlb

DIOPT Version :9

Sequence 1:NP_001097521.3 Gene:CG32413 / 318018 FlyBaseID:FBgn0052413 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_001921878.1 Gene:qpctlb / 564655 ZFINID:ZDB-GENE-091118-40 Length:391 Species:Danio rerio


Alignment Length:375 Identity:96/375 - (25%)
Similarity:160/375 - (42%) Gaps:82/375 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RIALFLTIIYVVFKAMFLRWVIE-------------KPPFKFDDDEEH--FNATLAKL------- 46
            |:.|.|..:.|:. ||.|...:.             |||....|...|  ...|:|::       
Zfish    27 RVRLLLLCLCVLV-AMTLTLALSLANQHPEEFDLPPKPPDLIKDKLNHQPGKPTVAQVKRLISQV 90

  Fly    47 ---------LKP----RSVGSKGHAEVQDFIETELKRL---------DFITLKNDFQQG-VNITN 88
                     |:|    |..||:|...|:..|.::|..|         .||   ::..:| |:.:|
Zfish    91 NWERLWYFQLRPILIQRQPGSRGSRAVRKHIFSQLDSLSAGWSVEVDSFI---SETPRGPVSFSN 152

  Fly    89 LVGFWNMRAKFYLMLTCHYDSK-------KPENVTTDEFLAAAEGAVSCAILLNVAKTLRQFLID 146
            ::...:..|...|:|.||||||       :|:.|    |:.|::.||.||::|.:...|...|..
Zfish   153 ILAVLDPMAPRRLLLACHYDSKLIPSDASEPQKV----FVGASDSAVPCAMMLELVTALDAHLKK 213

  Fly   147 RWSEKKSVGLAFIFFDGHNSLSS-DPYDENELLGATHFID-----------EEFIPLRDMAVAVT 199
            .......|.|..:||||..:... .|.|  .|.|:.|..:           |:...|..:.:.|.
Zfish   214 HKQLMSRVTLQLVFFDGGEAFEQWSPTD--SLYGSRHLAEYMSSIPHPPGSEQTTLLNAVDLLVL 276

  Fly   200 LSYIGAPNQTFLSFFEVTNDLHNLIADIEQDLRKSGELDDCHVLFQKKTHYDKDL-----LDDHI 259
            |..|||.:..|::.|:.|....:.:...|:.|...|.|.. |.  :::.::.||:     .|||:
Zfish   277 LDLIGAADPMFVNHFDNTARWFDRLIAAEKRLHTLGLLSS-HP--KEQRYFIKDMNMGPVEDDHL 338

  Fly   260 VFDEQDVPVIHVSPHEFPNVLYTPADNVENLHYPTIRNMIKIIRCFVHDF 309
            .|.::.|||:|:....||:.|:|..|..:.:|..|:.|:.||:..|:.::
Zfish   339 PFLQRGVPVLHLIATPFPSFLHTMEDTADKIHRHTVENLTKILVVFLAEY 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32413NP_001097521.3 M28_QC_like 19..309 CDD:349876 91/358 (25%)
qpctlbXP_001921878.1 M28_QC_like 81..388 CDD:193501 83/318 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577746
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1257754at2759
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.