DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32413 and qpct

DIOPT Version :9

Sequence 1:NP_001097521.3 Gene:CG32413 / 318018 FlyBaseID:FBgn0052413 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001017245.1 Gene:qpct / 549999 XenbaseID:XB-GENE-953343 Length:359 Species:Xenopus tropicalis


Alignment Length:363 Identity:102/363 - (28%)
Similarity:159/363 - (43%) Gaps:72/363 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RIALF--------LTIIYVVFKAMFLRWVIEKPPFK--------------FDDDEEHFNATLAKL 46
            ||||.        :.:|:...:::..||..||...:              ..|..:.|...|..:
 Frog     9 RIALICGAFYLLSVCVIHTNGQSVSSRWTTEKNSHRPVVLHTSDIQKVLSQTDVGQMFQTDLKPM 73

  Fly    47 LKPRSVGSKGHAEVQDFIETELKRLD--FITLKNDFQQG-----VNITNLVGFWNMRAKFYLMLT 104
            |..|..||.|:..|:..|:..|:.|.  ::|.::.|:..     |..:|::...|..||.:|:|.
 Frog    74 LTERYAGSPGNYAVRQHIKQRLQSLQAGWVTEEDTFEAPTPYGYVTFSNIISTLNPSAKRHLVLA 138

  Fly   105 CHYDSK--KPE---NVTTDEFLAAAEGAVSCAILLNVAKTLRQFLIDRWSEKKSVGLAFIFFDGH 164
            ||||||  .|:   .|    |:.|.:.||.||::|.:|:.|...|..:.:.|..:.|..|||||.
 Frog   139 CHYDSKYFSPQWDGRV----FVGAIDAAVPCAMMLELARALDSSLKKKLNSKLDLSLQLIFFDGE 199

  Fly   165 NSLSS-DPYDENELLGATHFID-----------EEFIPLRDMAVAVTLSYIGAPNQTFLSFFEVT 217
            .:... ..||  .|.|:.|...           |....|..:.:.:.|..||..|..|.::|:.|
 Frog   200 EAFQRWSSYD--SLYGSKHLAQKMETISHPPNAENTNQLHGIDLFILLDLIGTANPVFPNYFQNT 262

  Fly   218 NDLHNLIADIEQDLRKSGELDDCHVLFQKKTHYD-----------KDLLDDHIVFDEQDVPVIHV 271
            ....|.:..||:.|         |.|...|.|..           :.:||||:.|.::.||::|:
 Frog   263 ARWFNRLQSIERRL---------HGLNLLKNHPSEVQYFQSGFRARPVLDDHVPFLQRGVPILHL 318

  Fly   272 SPHEFPNVLYTPADNVENLHYPTIRNMIKIIRCFVHDF 309
            .|..||.|.:|..||.|||...||.|:.||::.||.::
 Frog   319 IPSPFPEVWHTMEDNEENLDSATIENLNKILQVFVLEY 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32413NP_001097521.3 M28_QC_like 19..309 CDD:349876 97/338 (29%)
qpctNP_001017245.1 M28_QC_like 51..356 CDD:349876 93/319 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1257754at2759
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.