DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32413 and isoQC

DIOPT Version :9

Sequence 1:NP_001097521.3 Gene:CG32413 / 318018 FlyBaseID:FBgn0052413 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_788550.1 Gene:isoQC / 40270 FlyBaseID:FBgn0036999 Length:354 Species:Drosophila melanogaster


Alignment Length:296 Identity:100/296 - (33%)
Similarity:147/296 - (49%) Gaps:30/296 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DEEHFNATLAKLLKPRSVGSKGHAEVQDFIETELKRLDFITLKNDFQQGVNIT------NLVGFW 93
            |:.|....:.|:|.||.||:..|:.|:::|...|:.||:....|.|.....|.      |::...
  Fly    60 DKLHLREAIDKILIPRVVGTTNHSIVREYIVQSLRDLDWDVEVNSFHDHAPIKGKLHFHNIIATL 124

  Fly    94 NMRAKFYLMLTCHYDSKKPENVTTDEFLAAAEGAVSCAILLNVAKTLRQFLIDRWSEKKSVGLAF 158
            |..|:.||:|:||||||....|   |||.|.:.||.||:|||:|:.|::.|  :..:|..:.|..
  Fly   125 NPNAERYLVLSCHYDSKYMPGV---EFLGATDSAVPCAMLLNLAQVLQEQL--KPLKKSKLSLML 184

  Fly   159 IFFDGHNSLSS-DPYDENELLGATHFI----DEEFIPLRDMAVAVTLSYIGAPNQTFLSFFEVTN 218
            :||||..:... .|.|  .:.||.|..    .|..:...||.|.:.|  :|||:..|.||||.|.
  Fly   185 LFFDGEEAFEEWGPKD--SIYGARHLAKKWHHEGKLDRIDMLVLLDL--LGAPDPAFYSFFENTE 245

  Fly   219 DLHNLIADIEQDLRKSGELD----------DCHVLFQKKTHYDKDLLDDHIVFDEQDVPVIHVSP 273
            ..:..|..:|..|.|...|:          |....||.:......:.||||.|..::||::|:.|
  Fly   246 SWYMRIQSVETRLAKLQLLERYASSGVAQRDPTRYFQSQAMRSSFIEDDHIPFLRRNVPILHLIP 310

  Fly   274 HEFPNVLYTPADNVENLHYPTIRNMIKIIRCFVHDF 309
            ..||:|.:||.||...:.|.|..|:..|||.|..::
  Fly   311 VPFPSVWHTPDDNASVIDYATTDNLALIIRLFALEY 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32413NP_001097521.3 M28_QC_like 19..309 CDD:349876 100/294 (34%)
isoQCNP_788550.1 M28_QC_like 56..346 CDD:193501 100/294 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445049
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 41 1.000 Inparanoid score I487
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1257754at2759
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.