DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32413 and CG6168

DIOPT Version :9

Sequence 1:NP_001097521.3 Gene:CG32413 / 318018 FlyBaseID:FBgn0052413 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001287032.1 Gene:CG6168 / 39273 FlyBaseID:FBgn0036154 Length:342 Species:Drosophila melanogaster


Alignment Length:292 Identity:88/292 - (30%)
Similarity:142/292 - (48%) Gaps:37/292 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DEEHFNATLAKLLKPRSVGSKGHAEVQDFIETELKR------LDFITLKNDFQQGVNITNLVGFW 93
            |.|:....:.::...|:|.:.||:||:::|...||:      ||..|.|......|...|:|...
  Fly    59 DPENLRKNVQRIAIKRAVSTPGHSEVRNYIVDYLKKLNWNVELDIFTQKVPIMSNVTFHNIVARQ 123

  Fly    94 NMRAKFYLMLTCHYDSKKPENVTTDEFLAAAEGAVSCAILLNVAKTLR-QFLIDRWSEKKSVGLA 157
            |.:.:.|||..||||||..::.   :|:||.:.||.||::||:|..|: ||      .:..|.|.
  Fly   124 NPQTQRYLMFGCHYDSKYFKDF---DFMAATDSAVPCALMLNMATILKHQF------HRSQVSLM 179

  Fly   158 FIFFDGHN-----SLSSDPYDENEL--LGATH-FIDE-EFIPLRDMAVAVTLSYIGAPNQTF-LS 212
            .:||||..     |....||....|  |...| |:|: :...|.|:        |||.:..| .:
  Fly   180 LVFFDGEEAFGEWSQEDSPYGSRHLAELWEKHGFLDKIDLFVLPDL--------IGAKDVVFKKN 236

  Fly   213 FFEVTNDLHNLIADIEQDLRKSGELDDCHVLFQKKTHYDKDLLDDHIVFDEQDVPVIHVSPHEFP 277
            ..:.:...|.|: .:|..|.::|.:.....||:.:...|.|  |||:.|..::|||||:..:::|
  Fly   237 ILDTSGWFHRLV-QLELKLFQAGIVRSERPLFKFEPGIDVD--DDHLPFTRRNVPVIHLISNKYP 298

  Fly   278 NVLYTPADNVENLHYPTIRNMIKIIRCFVHDF 309
            .|.:...|...|:.|.|...:..::|.||.::
  Fly   299 AVWHQAEDVEMNVDYNTTEQVGLVLRMFVMEY 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32413NP_001097521.3 M28_QC_like 19..309 CDD:349876 88/290 (30%)
CG6168NP_001287032.1 M28_QC_like 49..330 CDD:193501 88/290 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445046
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 41 1.000 Inparanoid score I487
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1257754at2759
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.