DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32413 and Qpct

DIOPT Version :9

Sequence 1:NP_001097521.3 Gene:CG32413 / 318018 FlyBaseID:FBgn0052413 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_006239694.1 Gene:Qpct / 313837 RGDID:1562284 Length:362 Species:Rattus norvegicus


Alignment Length:298 Identity:98/298 - (32%)
Similarity:139/298 - (46%) Gaps:28/298 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EHFNATLAKLLKPRSVGSKGHAEVQDFIETELKRL--DFITLKNDFQQGV-----NITNLVGFWN 94
            |.:...|..||..|..||.|....:..|...::||  :::...:.|....     :.:|::...|
  Rat    65 EMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLN 129

  Fly    95 MRAKFYLMLTCHYDSKKPENVTTDEFLAAAEGAVSCAILLNVAKTLRQ---FLIDRWSEKKSVGL 156
            ..||.:|:|.||||||......:..|:.|.:.||.||::|.:|:.|.:   .|.|....:..:.|
  Rat   130 PEAKRHLVLACHYDSKYFPQWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSRPDLSL 194

  Fly   157 AFIFFDGHNS-LSSDPYDENELLGATHFIDEEFI-----------PLRDMAVAVTLSYIGAPNQT 209
            ..|||||..: |...|.|  .|.|:.|...:...           .|..|.:.|.|..|||.|.|
  Rat   195 RLIFFDGEEAFLHWSPQD--SLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPT 257

  Fly   210 FLSFFEVTNDLHNLIADIEQDLRKSGELDDCHVLFQK---KTHYDKDLLDDHIVFDEQDVPVIHV 271
            |.:||..|......:..|||.|.:.|.|.| |.|.:|   ...|...:.||||.|..:.|||:|:
  Rat   258 FPNFFPKTTRWFTRLQAIEQQLSELGLLKD-HSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHL 321

  Fly   272 SPHEFPNVLYTPADNVENLHYPTIRNMIKIIRCFVHDF 309
            ....||.|.:|..||.||||..||.|:.|||:.||.::
  Rat   322 IASPFPEVWHTMDDNEENLHSSTIDNLNKIIQVFVLEY 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32413NP_001097521.3 M28_QC_like 19..309 CDD:349876 98/296 (33%)
QpctXP_006239694.1 M28_QC_like 54..359 CDD:349876 98/296 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338308
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1257754at2759
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12283
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.