DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32413 and QPCT

DIOPT Version :9

Sequence 1:NP_001097521.3 Gene:CG32413 / 318018 FlyBaseID:FBgn0052413 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_036545.1 Gene:QPCT / 25797 HGNCID:9753 Length:361 Species:Homo sapiens


Alignment Length:299 Identity:100/299 - (33%)
Similarity:144/299 - (48%) Gaps:30/299 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EHFNATLAKLLKPRSVGSKGHAEVQDFIETELKRL--DFI----TLKNDFQQGV-NITNLVGFWN 94
            |.:...|..||..|..||.|....:..|...::||  |::    |..:....|. :.:|::...|
Human    64 EMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLN 128

  Fly    95 MRAKFYLMLTCHYDSKKPENVTTDEFLAAAEGAVSCAILLNVAKTLRQFLIDRWS---EKKSVGL 156
            ..||.:|:|.||||||...:.....|:.|.:.||.||::|.:|:.|.:.|:...:   .|..:.|
Human   129 PTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSL 193

  Fly   157 AFIFFDGHNS-LSSDPYDENELLGATHFIDE-EFIP----------LRDMAVAVTLSYIGAPNQT 209
            ..|||||..: |...|.|  .|.|:.|...: ...|          |..|.:.|.|..|||||.|
Human   194 QLIFFDGEEAFLHWSPQD--SLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPT 256

  Fly   210 FLSFFEVTNDLHNLIADIEQDLRKSGELDDCHVL----FQKKTHYDKDLLDDHIVFDEQDVPVIH 270
            |.:||..:......:..||.:|.:.|.|.| |.|    ||..: |...:.||||.|..:.|||:|
Human   257 FPNFFPNSARWFERLQAIEHELHELGLLKD-HSLEGRYFQNYS-YGGVIQDDHIPFLRRGVPVLH 319

  Fly   271 VSPHEFPNVLYTPADNVENLHYPTIRNMIKIIRCFVHDF 309
            :.|..||.|.:|..||.|||...||.|:.||::.||.::
Human   320 LIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEY 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32413NP_001097521.3 M28_QC_like 19..309 CDD:349876 100/297 (34%)
QPCTNP_036545.1 M28_QC_like 51..358 CDD:193501 100/297 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144607
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1257754at2759
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.