DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32409 and RRS1

DIOPT Version :9

Sequence 1:NP_729108.2 Gene:CG32409 / 318016 FlyBaseID:FBgn0052409 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_014937.1 Gene:RRS1 / 854469 SGDID:S000005820 Length:203 Species:Saccharomyces cerevisiae


Alignment Length:205 Identity:73/205 - (35%)
Similarity:107/205 - (52%) Gaps:33/205 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DKYK--PITVEKHLECRLDVGSLL-----ITDPNDFDDRELRDNKEEYLTALTRENTQLLVNAIW 73
            :.||  |:||||.:....|:|:|.     :.|.||.|....|  :||.:.:|||:|.|||:|.:.
Yeast     4 EDYKNLPVTVEKPIPVVYDLGNLAAFDSNVLDKNDLDSSNAR--REEKIKSLTRDNVQLLINQLL 66

  Fly    74 ELPTERVDESI-----------VAKLPEPTTVLPRLRKPPGPRPLTKWEKFAKEKGIS-KKKKDK 126
            .||.:...||:           :.:||:|||.|||.:..|..:.:|||||||.:|||. |::..|
Yeast    67 SLPMKTTTESVGGTGGQSSVMTLLQLPDPTTDLPREKPLPKAKAMTKWEKFAAKKGIKPKERAGK 131

  Fly   127 KTYDETMDKWVPTYGFKRAEAEKAKDWVLEVPQNA--------DPNTDMFQKKIDLRNEKVAKNE 183
            ..|||...:|||.:|:|.|..:....|::||....        ||.|   ..:.: |...|.|||
Yeast   132 MIYDEASGEWVPKWGYKGANKKLDDQWLVEVDDKVKGTDNELIDPRT---LNRAE-RKRLVKKNE 192

  Fly   184 IQRMKNIVRA 193
            .|:.:|:..|
Yeast   193 KQQRRNMKNA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32409NP_729108.2 RRS1 31..190 CDD:282755 64/183 (35%)
RRS1NP_014937.1 RRS1 9..203 CDD:227550 71/200 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345870
Domainoid 1 1.000 102 1.000 Domainoid score I1531
eggNOG 1 0.900 - - E1_COG5225
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41014
Inparanoid 1 1.050 112 1.000 Inparanoid score I1368
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004650
OrthoInspector 1 1.000 - - oto99134
orthoMCL 1 0.900 - - OOG6_102760
Panther 1 1.100 - - LDO PTHR17602
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1227
SonicParanoid 1 1.000 - - X3268
TreeFam 00.000 Not matched by this tool.
1312.820

Return to query results.
Submit another query.