DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32409 and rrs1

DIOPT Version :9

Sequence 1:NP_729108.2 Gene:CG32409 / 318016 FlyBaseID:FBgn0052409 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_595844.1 Gene:rrs1 / 2540324 PomBaseID:SPBC29A3.16 Length:166 Species:Schizosaccharomyces pombe


Alignment Length:168 Identity:54/168 - (32%)
Similarity:94/168 - (55%) Gaps:10/168 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VEKHLECRLDVGSLLITDPNDFDDRELR-DNKEEYLTALTRENTQLLVNAIWELPTERVDESIVA 86
            :|..:....|:|::...|.:..|:.:|. ..||.:|.:|:|:|.|.|||.:..||.||..:.::.
pombe     5 IENSIPLDFDLGNMAAFDISPLDETKLSGSEKESFLFSLSRDNVQQLVNKMISLPKERTSDGVLL 69

  Fly    87 KLPEPTTVLPRLRKPPGPRPLTKWEKFAKEKGISKKKKD-KKTYDETMDKWVPTYGFKRAEAEKA 150
            :|||..|.|||.:..|.|:|.|||::||:.|||:.||:: :..:||...:|||.:|:|....|..
pombe    70 QLPETVTPLPRAKPLPKPKPETKWQRFARIKGIAPKKREGRLVFDEASGEWVPKWGYKGKNKELE 134

  Fly   151 KDWVLEVPQNADPNTDMFQKKIDLRNEKVAKNEIQRMK 188
            ..|::|..:.        :||:..:..:....:|:|.:
pombe   135 TQWLVEEGEK--------EKKLTSKQVRNTSKKIKRSR 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32409NP_729108.2 RRS1 31..190 CDD:282755 53/160 (33%)
rrs1NP_595844.1 RRS1 1..166 CDD:227550 54/168 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 102 1.000 Domainoid score I1765
eggNOG 1 0.900 - - E1_COG5225
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41014
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004650
OrthoInspector 1 1.000 - - oto100659
orthoMCL 1 0.900 - - OOG6_102760
Panther 1 1.100 - - LDO PTHR17602
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1227
SonicParanoid 1 1.000 - - X3268
TreeFam 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.