DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32409 and rrs1

DIOPT Version :9

Sequence 1:NP_729108.2 Gene:CG32409 / 318016 FlyBaseID:FBgn0052409 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001096310.1 Gene:rrs1 / 100124888 XenbaseID:XB-GENE-5875601 Length:123 Species:Xenopus tropicalis


Alignment Length:136 Identity:59/136 - (43%)
Similarity:79/136 - (58%) Gaps:21/136 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 VAKSSTASVGKFQNKLPKEKEARGLGIKELIPGGKRKQSHITQ-TPEKEANLDLIKSVLNKKPKL 283
            |||.||||.|:||:|||||||.|.:|.|      ::.|..|.. :.||...||::|.:.:|||.|
 Frog     3 VAKVSTASAGRFQDKLPKEKEPRNMGKK------RKFQPLIGDFSVEKSKQLDILKVMGSKKPAL 61

  Fly   284 DVSKAVSMEKRDNRLAREAEAENEPGK--KGGKKPKGKGSRKAVGKKSKG---NRGQRAPGKKAQ 343
            |::|||      |:..||.:|| |..|  ||||  ||:|.::..|||.||   .:|:...||...
 Frog    62 DMTKAV------NKQMREEDAE-EAAKRRKGGK--KGRGGKQQGGKKGKGKGPGKGKHPRGKGIG 117

  Fly   344 AGRKRR 349
            ..||.:
 Frog   118 GKRKHK 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32409NP_729108.2 RRS1 31..190 CDD:282755
rrs1NP_001096310.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8461
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1264304at2759
OrthoFinder 1 1.000 - - FOG0004650
OrthoInspector 1 1.000 - - oto102633
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3268
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.