DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Av and Cpr65Au

DIOPT Version :9

Sequence 1:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001286953.1 Gene:Cpr65Au / 59158 FlyBaseID:FBgn0042119 Length:106 Species:Drosophila melanogaster


Alignment Length:105 Identity:44/105 - (41%)
Similarity:67/105 - (63%) Gaps:5/105 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQSSSICVLAICAFALLSTIRAAPLDDSQHATILRYDNDNIGTDGYNFGYETSDGVTRQEQAEVK 65
            |||:.:.::|..|..:.....|.  :|:|..|| :.:::|.| |.|:|.||||:|::|.|..|||
  Fly     1 MQSNFMWLVAFLAIGICLAFPAG--EDAQAETI-KLESENTG-DKYSFAYETSNGISRTETGEVK 61

  Fly    66 -NAGTDQEALSVRGSVSWVAPDGQTYTLHYIADENGFQPQ 104
             .||.:..:|||:||.||.||||:.|.:.:.|||.|:.|:
  Fly    62 PGAGEEDGSLSVQGSTSWSAPDGKKYEISFTADETGYHPK 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:278791 29/55 (53%)
Cpr65AuNP_001286953.1 Chitin_bind_4 42..98 CDD:278791 29/55 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508073at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.