DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Av and Lcp65Ab2

DIOPT Version :9

Sequence 1:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_788469.1 Gene:Lcp65Ab2 / 48381 FlyBaseID:FBgn0020643 Length:104 Species:Drosophila melanogaster


Alignment Length:80 Identity:37/80 - (46%)
Similarity:54/80 - (67%) Gaps:2/80 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ATILRYDNDNIGTDGYNFGYETSDGVTRQEQAEVKNAGTDQEALSVRGSVSWV-APDGQTYTLHY 94
            |.|:|..:| :..:.::...|||||.:.:::..:||||||.||..|.||.:|| ...|:.:|:.|
  Fly    21 AEIVRQVSD-VEPEKWSSDVETSDGTSIKQEGVLKNAGTDNEAAVVHGSFTWVDEKTGEKFTITY 84

  Fly    95 IADENGFQPQGDHLP 109
            :|||||:||||.|||
  Fly    85 VADENGYQPQGAHLP 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:278791 25/55 (45%)
Lcp65Ab2NP_788469.1 Chitin_bind_4 40..91 CDD:306811 25/50 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.