DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Av and LOC4578368

DIOPT Version :10

Sequence 1:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_001238134.2 Gene:LOC4578368 / 4578368 VectorBaseID:AGAMI1_001083 Length:193 Species:Anopheles gambiae


Alignment Length:57 Identity:18/57 - (31%)
Similarity:25/57 - (43%) Gaps:5/57 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 YNFGYETSDGVTRQEQAEVKNAGTDQEALSVRGSVSWVAPDGQTYTLHYIADE-NGF 101
            |.|.|...|..|    .:||:....:....|:|..|.:..||....:.|.||: |||
Mosquito   111 YEFSYSVHDSHT----GDVKSQHETRHGDQVQGQYSLLDADGHQRIVDYTADDHNGF 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 16/55 (29%)
LOC4578368XP_001238134.2 None

Return to query results.
Submit another query.