DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Av and LOC4576972

DIOPT Version :10

Sequence 1:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_001230824.3 Gene:LOC4576972 / 4576972 VectorBaseID:AGAMI1_012517 Length:186 Species:Anopheles gambiae


Alignment Length:82 Identity:29/82 - (35%)
Similarity:37/82 - (45%) Gaps:10/82 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AAPLDDSQ-HATILRYDNDNIGTDGYNFGYETSDGVTRQEQAEVKNAGTDQEALSVRGSVSWVAP 85
            ||||..:: .|....||    ....|::.|..:|.||    .:.||....:....|.||.|.|.|
Mosquito    63 AAPLAVAKVAAPYAEYD----ANPQYSYSYAVADAVT----GDNKNQQESRSGDVVTGSYSLVEP 119

  Fly    86 DGQTYTLHYIADE-NGF 101
            ||...|:.|.||. |||
Mosquito   120 DGTRRTVEYNADPINGF 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 20/55 (36%)
LOC4576972XP_001230824.3 None

Return to query results.
Submit another query.