DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Av and LOC4576733

DIOPT Version :10

Sequence 1:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_001237148.2 Gene:LOC4576733 / 4576733 VectorBaseID:AGAMI1_004026 Length:143 Species:Anopheles gambiae


Alignment Length:68 Identity:18/68 - (26%)
Similarity:27/68 - (39%) Gaps:9/68 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 YNFGYETSDGVT--RQEQAEVKNAGTDQEALSVRGSVSWVAPDGQTYTLHYIAD-ENGFQPQGDH 107
            |.|.|...|..|  .:.|.||::...      |:|..:....||....:.|.:| .|||:.....
Mosquito    34 YKFEYGVKDPHTGDHKTQWEVRDGDV------VKGQYTLHEADGTERVVDYKSDGHNGFEADVKK 92

  Fly   108 LPH 110
            :.|
Mosquito    93 VGH 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 15/57 (26%)
LOC4576733XP_001237148.2 Chitin_bind_4 34..86 CDD:459790 15/57 (26%)

Return to query results.
Submit another query.