DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Av and Cpr97Ea

DIOPT Version :10

Sequence 1:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_651529.2 Gene:Cpr97Ea / 43258 FlyBaseID:FBgn0039480 Length:366 Species:Drosophila melanogaster


Alignment Length:102 Identity:28/102 - (27%)
Similarity:42/102 - (41%) Gaps:21/102 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 STIRAAPLDDSQHA-------------TILRYDNDNIGTDGYNFGYETSDGVTRQEQAEVKNAGT 69
            :|.|.|||....:|             .||:..|.:.....|.:|||.:||..:.|        |
  Fly    31 NTPRTAPLRLRANAAPARAEAPRADPVAILKQINKHNEDGSYTYGYEGADGSFKIE--------T 87

  Fly    70 DQEALSVRGSVSWVAPDGQTYTLHYIADENGFQPQGD 106
            ......|:|...:|...|:...:.|.|::.||||.|:
  Fly    88 KLATGEVKGKYGYVDETGKVRVVEYGANKYGFQPSGE 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 14/54 (26%)
Cpr97EaNP_651529.2 Chitin_bind_4 72..119 CDD:459790 14/54 (26%)

Return to query results.
Submit another query.