DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Av and CG8927

DIOPT Version :10

Sequence 1:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster


Alignment Length:86 Identity:25/86 - (29%)
Similarity:34/86 - (39%) Gaps:26/86 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TILRYDNDNIGTDG-YNFGYETSDGVTRQEQAEVKNAGTDQEALSVRGSVSWVAPDGQTYTLHYI 95
            ||.::..:|  .|| ..:|||..||..::|.     .|||   ...:|:..:|.|||.....||.
  Fly   261 TIRKWREEN--EDGSITWGYENDDGSFKEEL-----IGTD---CITKGTYGYVDPDGNKREYHYE 315

  Fly    96 A---------------DENGF 101
            .               .||||
  Fly   316 TGIKCDPNNRNNEEELQENGF 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 18/69 (26%)
CG8927NP_650527.2 Chitin_bind_4 277..336 CDD:459790 18/66 (27%)

Return to query results.
Submit another query.