DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Av and Ccp84Aa

DIOPT Version :10

Sequence 1:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster


Alignment Length:89 Identity:25/89 - (28%)
Similarity:36/89 - (40%) Gaps:12/89 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LSTIRAAPLDDSQHATIL---RYDNDNIGTDGYNFGYETSDGVTRQEQAEVKNAGTDQEALSVRG 78
            ::|...||:..:|...:.   .||..    ..|.|.|...|.:|...:.:|:....|    .|||
  Fly    34 VATYAHAPVAVAQKVVVKAAEEYDPH----PQYRFSYGVDDKLTGDNKGQVEERDGD----VVRG 90

  Fly    79 SVSWVAPDGQTYTLHYIADE-NGF 101
            ..|.:..||....:.|.||. |||
  Fly    91 EYSLIDADGYKRIVQYTADPINGF 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 17/55 (31%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:459790 17/55 (31%)

Return to query results.
Submit another query.