DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Av and Ccp84Ac

DIOPT Version :10

Sequence 1:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster


Alignment Length:57 Identity:19/57 - (33%)
Similarity:29/57 - (50%) Gaps:5/57 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 YNFGYETSDGVTRQEQAEVKNAGTDQEALSVRGSVSWVAPDGQTYTLHYIADE-NGF 101
            |||.|:..|.::...:::|::...|    .|:|..|....||...|:.|.||. |||
  Fly    65 YNFAYDVQDALSGDSKSQVESRDGD----VVQGEYSLDDADGFRRTVKYTADSVNGF 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 17/55 (31%)
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:459790 17/55 (31%)

Return to query results.
Submit another query.