DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Av and Ccp84Af

DIOPT Version :10

Sequence 1:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:126 Identity:28/126 - (22%)
Similarity:46/126 - (36%) Gaps:29/126 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAICAFALLSTIRAA-----PLDDSQHA--TILRYDNDNIGT-----------------DGYNFG 49
            :|...||:|:.|.||     |:....||  .:..|....:..                 ..|.|.
  Fly     1 MAFKFFAVLALISAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEYDPHPQYKFA 65

  Fly    50 YETSDGVTRQEQAEVKNAGTDQEALSVRGSVSWVAPDGQTYTLHYIADE-NGFQPQGDHLP 109
            |:..|.::...:::|:....|    .|.|..|.:..||....:.|.:|. |||....:.:|
  Fly    66 YDVQDSLSGDSKSQVEERDGD----VVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVP 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 14/55 (25%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 14/55 (25%)

Return to query results.
Submit another query.