DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Av and Cpr67Fb

DIOPT Version :10

Sequence 1:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_648420.1 Gene:Cpr67Fb / 39225 FlyBaseID:FBgn0036110 Length:122 Species:Drosophila melanogaster


Alignment Length:100 Identity:45/100 - (45%)
Similarity:58/100 - (57%) Gaps:13/100 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ICAFALLSTIRAAPLDDSQHATILRYDNDNIGTDG-YNFGYETSDGVTRQEQAEVKNAGTDQEAL 74
            |.:..|::.||||  |:|| |...:|.|: |..|| |::.|.||:|:..||    ...|..|.| 
  Fly     7 IISLFLVAAIRAA--DESQ-AETTKYRNE-IKPDGSYSWEYGTSNGIDAQE----SGVGGVQAA- 62

  Fly    75 SVRGSVSWVAPDGQTYTLHYIADENGFQPQGDHLP 109
               ||||:.||||....|.|.|||||::|.|.|||
  Fly    63 ---GSVSYAAPDGTPIQLEYTADENGYRPTGAHLP 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 24/54 (44%)
Cpr67FbNP_648420.1 Chitin_bind_4 39..86 CDD:459790 24/54 (44%)

Return to query results.
Submit another query.