DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Av and Acp65Aa

DIOPT Version :10

Sequence 1:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster


Alignment Length:103 Identity:54/103 - (52%)
Similarity:77/103 - (74%) Gaps:4/103 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLAICAFALLSTIRAA-PLDDSQHATILRYDNDNIGTDGYNFGYETSDGVTRQEQAEVKNAGTDQ 71
            :|.:.:.|||..:.:| |.:|.:   :|.|:::|.|..||.|.|:.|||.:|.|:..|.|||||.
  Fly     5 MLVVGSIALLLALASARPQNDVE---VLEYESENTGLGGYKFSYKLSDGTSRTEEGVVNNAGTDN 66

  Fly    72 EALSVRGSVSWVAPDGQTYTLHYIADENGFQPQGDHLP 109
            |::|:||||:||||||||||::::||||||||:|.|||
  Fly    67 ESISIRGSVTWVAPDGQTYTINFVADENGFQPEGAHLP 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 34/54 (63%)
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 34/54 (63%)

Return to query results.
Submit another query.