DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Av and Lcp65Ac

DIOPT Version :9

Sequence 1:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_477279.1 Gene:Lcp65Ac / 38708 FlyBaseID:FBgn0020642 Length:109 Species:Drosophila melanogaster


Alignment Length:104 Identity:58/104 - (55%)
Similarity:76/104 - (73%) Gaps:2/104 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CVLAICAFALLSTIRAAPLDDSQHATILRYDNDNIGTDGYNFGYETSDGVTRQEQAEVKNAGTDQ 71
            |.:||...||.:.:.|||..|:. ..|||.::| :..:||||..|||||...:||.::||.||:|
  Fly     3 CTVAIVFTALFAVVLAAPAPDAD-TQILRLESD-VQPEGYNFALETSDGKKHEEQGQLKNVGTEQ 65

  Fly    72 EALSVRGSVSWVAPDGQTYTLHYIADENGFQPQGDHLPH 110
            ||:.||||.|:||.||||||::||||||||||:|.|||:
  Fly    66 EAIVVRGSYSFVADDGQTYTVNYIADENGFQPEGAHLPN 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:278791 36/54 (67%)
Lcp65AcNP_477279.1 Chitin_bind_4 40..95 CDD:278791 36/54 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27015
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.