DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Av and l(3)mbn

DIOPT Version :10

Sequence 1:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_729143.2 Gene:l(3)mbn / 38701 FlyBaseID:FBgn0002440 Length:653 Species:Drosophila melanogaster


Alignment Length:61 Identity:16/61 - (26%)
Similarity:22/61 - (36%) Gaps:26/61 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 ITAPNITDCISIL--HLPRNSTLAKEFENLGRIEDNYNSTSPTQIHKGGGKAEPVKSNGWK 204
            :.:|....|.|.|  |.|:.||               .|:|.|         .|:|:|.||
  Fly    11 LQSPPSRPCPSFLANHEPKLST---------------TSSSVT---------FPLKTNTWK 47

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790
l(3)mbnNP_729143.2 Chitin_bind_4 575..621 CDD:459790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.