DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Av and Cpr57A

DIOPT Version :10

Sequence 1:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster


Alignment Length:68 Identity:20/68 - (29%)
Similarity:31/68 - (45%) Gaps:12/68 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 IKINATLAAHLPSACHITAPNITDCISILHLPRNSTLAKEFENLGRIEDNYNSTSPTQIHKGGGK 194
            :|.|.:|...|.:...|   ||.|.:.:.|...::|.  ...||.|    ::|:|.|   :|.|.
  Fly     4 LKKNHSLLLLLNNNLRI---NINDKLPLNHATTDNTY--NCNNLKR----HSSSSST---RGSGA 56

  Fly   195 AEP 197
            |.|
  Fly    57 ARP 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 11/37 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.