DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Av and Cpr23B

DIOPT Version :10

Sequence 1:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster


Alignment Length:66 Identity:20/66 - (30%)
Similarity:33/66 - (50%) Gaps:5/66 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 YNFGYETSDGVTRQEQAEVKNAGTDQEALSVRGSVSWVAPDGQTYTLHYIADE-NGFQPQGDHLP 109
            |:|.|..:|..|    .::|.....::...|||..|.:.|||...|:.|.||: :||....:.:|
  Fly   157 YSFNYAVNDAST----GDIKEHSETRDGYVVRGFYSLIDPDGYKRTVTYTADDVHGFNAVVNRVP 217

  Fly   110 H 110
            :
  Fly   218 Y 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 17/55 (31%)
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:459790 17/55 (31%)

Return to query results.
Submit another query.