DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Av and LOC3290255

DIOPT Version :10

Sequence 1:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_565333.2 Gene:LOC3290255 / 3290255 VectorBaseID:AGAMI1_006467 Length:182 Species:Anopheles gambiae


Alignment Length:79 Identity:19/79 - (24%)
Similarity:33/79 - (41%) Gaps:10/79 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YD-NDNIGTDGYNFGYETSDGVT--RQEQAEVKNAGTDQEALSVRGSVSWVAPDGQTYTLHYIAD 97
            || :|:.....|.:.|...|..|  .:.|.|:::...      |:|..:....||....:.|.:|
Mosquito    77 YDYSDHYAYPKYKYDYGVQDAHTGDHKSQWEIRDGDV------VKGGYTLYDADGTKRVVEYSSD 135

  Fly    98 E-NGFQPQGDHLPH 110
            : :|||.....:.|
Mosquito   136 KHHGFQAHVKRVGH 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 12/57 (21%)
LOC3290255XP_565333.2 Chitin_bind_4 88..140 CDD:459790 12/57 (21%)

Return to query results.
Submit another query.