DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Av and LOC3290141

DIOPT Version :10

Sequence 1:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_556986.2 Gene:LOC3290141 / 3290141 VectorBaseID:AGAMI1_005909 Length:201 Species:Anopheles gambiae


Alignment Length:67 Identity:17/67 - (25%)
Similarity:32/67 - (47%) Gaps:5/67 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DNIGTDGYNFGYETSDGVTRQEQAEVKNAGTDQEALSVRGSVSWVAPDGQTYTLHYIADE-NGFQ 102
            |.:....|.|.|...|..::..|:..::...|:    :.|..|...|||:..|:.|.::: :|||
Mosquito    65 DYVAKPDYVFEYGVEDPKSKVSQSRKEHRHEDE----LHGEYSLHQPDGKLRTVKYSSNKHSGFQ 125

  Fly   103 PQ 104
            .:
Mosquito   126 AE 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 13/55 (24%)
LOC3290141XP_556986.2 Chitin_bind_4 72..124 CDD:459790 13/55 (24%)

Return to query results.
Submit another query.