DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Av and LOC3290085

DIOPT Version :10

Sequence 1:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_556680.3 Gene:LOC3290085 / 3290085 VectorBaseID:AGAMI1_011772 Length:134 Species:Anopheles gambiae


Alignment Length:112 Identity:41/112 - (36%)
Similarity:55/112 - (49%) Gaps:22/112 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ICVLAICAFALLSTI--RAAPLDDSQH----ATILRYDNDNIGTDGYNFGYETSDGVTRQEQAEV 64
            :|:|   ||.|.||:  .|.|..:..|    ..|:..:|      |..|.|:|.|...|.|..| 
Mosquito     6 VCLL---AFLLASTLLTDARPAMEKDHNFHYYEIISTEN------GQLFSYKTKDNQWRDETVE- 60

  Fly    65 KNAGTDQEA--LSVRGSVSWVAPDGQTYTLHYIADENGFQPQGDHLP 109
                ||.:.  |.:.|...:|.|||.||.:.|:|||||::|.|.|||
Mosquito    61 ----TDPKTGKLVISGWYRYVGPDGVTYQVKYVADENGYRPLGMHLP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 22/56 (39%)
LOC3290085XP_556680.3 None

Return to query results.
Submit another query.