DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Av and LOC1273356

DIOPT Version :10

Sequence 1:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_312323.3 Gene:LOC1273356 / 1273356 VectorBaseID:AGAMI1_007369 Length:131 Species:Anopheles gambiae


Alignment Length:114 Identity:40/114 - (35%)
Similarity:66/114 - (57%) Gaps:9/114 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQSSSICVLAICAFALLSTIRAAPLDDSQHATILRYDNDNIGTDGYNFGYETSDGVTRQEQAEVK 65
            ||......|.:|  .|:.....||:|......|::|:|:|..::|||||:|.||...|:|:..::
Mosquito     1 MQQQVFAFLVLC--TLVGAAVGAPVDSGATPYIVQYENNNAQSEGYNFGFELSDEQRRKEEGTIR 63

  Fly    66 ----NAGTDQEALSVRGSVSWVAPDGQTYTLHYIADENGFQPQ---GDH 107
                ..|.|.:.::|:|..|:|..||:||.:.|:|||||::.:   ||:
Mosquito    64 YSKDEEGKDVQFVAVQGHYSYVGDDGRTYWVEYVADENGYRSRMGTGDY 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 24/58 (41%)
LOC1273356XP_312323.3 Chitin_bind_4 44..103 CDD:459790 24/58 (41%)

Return to query results.
Submit another query.