DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Av and LOC1272762

DIOPT Version :10

Sequence 1:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_311670.4 Gene:LOC1272762 / 1272762 VectorBaseID:AGAMI1_005929 Length:138 Species:Anopheles gambiae


Alignment Length:81 Identity:26/81 - (32%)
Similarity:37/81 - (45%) Gaps:17/81 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AAPLDDSQHATILRYDNDNIGTDGYNFGYETSDGVTRQEQAEVKNAGTDQEALSVRGSVSWVAPD 86
            ||||.|        ||.:    ..|::.|..||.:|...:::.::...|    .|.||.|.:.||
Mosquito    36 AAPLAD--------YDPN----PQYSYSYAVSDALTGDNKSQQESRSGD----VVSGSYSLIEPD 84

  Fly    87 GQTYTLHYIADE-NGF 101
            |....:.|.||. |||
Mosquito    85 GTQRVVEYTADPVNGF 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 17/55 (31%)
LOC1272762XP_311670.4 Chitin_bind_4 48..100 CDD:459790 17/55 (31%)

Return to query results.
Submit another query.