DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or19a

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster


Alignment Length:250 Identity:40/250 - (16%)
Similarity:96/250 - (38%) Gaps:46/250 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 PLWVHQQILPLHAAFPFQWHEKSIHPISHAFIYLFQTWNVMYFLTWLVCIEGLSVSIYVEITFAI 236
            |.|:           |:.|.:.:...::.|.::   |..:|...|.::.:.....:..:.::...
  Fly   159 PTWI-----------PWNWRDSTSAYLATAMLH---TTALMANATLVLNLSSYPGTYLILVSVHT 209

  Fly   237 EVLCLELRHLHQRCHGY----EQLRLETNRL--VQFHQKIVHILDHTNK--------VFHGTLIM 287
            :.|.|.:..|     ||    ..:|::...:  :..||.|:.:.....:        .|..|...
  Fly   210 KALALRVSKL-----GYGAPLPAVRMQAILVGYIHDHQIILRLFKSLERSLSMTCFLQFFSTACA 269

  Fly   288 QMGVNFFLV--SLSVLEAMEARKDPKVVAQFAVLMLLALGHLSMWSYFGDLLSQKSLTISEAAYE 350
            |..:.:||:  ::.::..|          ....|:::......:..|..:|..::..::..|.|.
  Fly   270 QCTICYFLLFGNVGIMRFM----------NMLFLLVILTTETLLLCYTAELPCKEGESLLTAVYS 324

  Fly   351 AYDPIKGSKDVYRDLCLIIRRGQEPLIMRASPFPSFNFINYSAILNQCYGILTFL 405
            . :.:..|.:..|.|.|::.|.|.|:|:.:......:...::.::...|.:||.|
  Fly   325 C-NWLSQSVNFRRLLLLMLARCQIPMILVSGVIVPISMKTFTVMIKGAYTMLTLL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 36/242 (15%)
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 36/242 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465209
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.