DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or98b

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster


Alignment Length:351 Identity:69/351 - (19%)
Similarity:131/351 - (37%) Gaps:94/351 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 ERQMPYRSSWHTLVIIQATVCF--LTMCYGV-----TESLGDKV-----------QMG------R 91
            |:.:.:|..|.::..|.:...|  ||:.:|:     .|.|.|.:           ::|      :
  Fly    24 EQDVGHRYPWRSICCILSVASFMPLTIAFGLQNVQNVEQLTDSLCSVLVDLLALCKIGLFLWLYK 88

  Fly    92 DIAFIIGFFYIAFKIYYFQWYGDELDEVVEALETFHPWAQKGPGAVDYRTAKRWYFTLAFFLASS 156
            |..|:||.||...:.       :....|.|.:.|              |.::|..|..|.:.   
  Fly    89 DFKFLIGQFYCVLQT-------ETHTAVAEMIVT--------------RESRRDQFISAMYA--- 129

  Fly   157 WLVFLCIFILLLITSPLWV---HQQILPLHAAFPFQWHEKSIHPISHAFIYLFQTWNVMYFLTWL 218
             ..|:...:...:.|||.:   :|:...|...|||    .|::|..:..:   ..:.:.||  |.
  Fly   130 -YCFITAGLSACLMSPLSMLISYQRTGELQPKFPF----PSVYPWDNMKL---SNYIISYF--WN 184

  Fly   219 VCIEGLSVSIYVEITFAIEVLCLELRH----LHQRCHGYEQLRLETNRLVQFHQKIVHI------ 273
            || ..|.|::   .|..::.|...|.|    |.|... ::.:..|.....:.|:.:.|:      
  Fly   185 VC-AALGVAL---PTVCVDTLFCSLSHNLCALFQIAR-HKMMHFEGRNTKETHENLKHVFQLYAL 244

  Fly   274 ---LDHTNKVFHGTLIMQ-------MGVNFFLVSLSVLEAMEARKDPKVVAQFAVLMLLALGHLS 328
               |.|....:...||.|       :.|..:.:|.::|:       |.::. :|......:|.:|
  Fly   245 CLNLGHFLNEYFRPLICQFVAASLHLCVLCYQLSANILQ-------PALLF-YAAFTAAVVGQVS 301

  Fly   329 MWSYFGDLLSQKSLTISEAAYEAYDP 354
            ::.:.|..:..:.....:|.||:..|
  Fly   302 IYCFCGSSIHSECQLFGQAIYESSWP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 58/308 (19%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 61/316 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.