DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or98a

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:391 Identity:67/391 - (17%)
Similarity:133/391 - (34%) Gaps:83/391 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 WHT----LVIIQATVCFLTMCYGVTESLGDKVQMGRDI--------AFIIGFFY----IAFKIYY 108
            |||    .:|...|.|.:.....|...:|..:....||        ..::..|:    :.||:.:
  Fly    33 WHTPATHKIIYYITSCLIFAWCAVYLPIGIIISFKTDINTFTPNELLTVMQLFFNSVGMPFKVLF 97

  Fly   109 FQWY-------GDELDEVVEALETFHPWAQKGPGAVDYRTAKRWY------FTLAFFLASS---- 156
            |..|       ...|.|:.:...|.....:...|.|....|...|      :|::.||:::    
  Fly    98 FNLYISGFYKAKKLLSEMDKRCTTLKERVEVHQGVVRCNKAYLIYQFIYTAYTISTFLSAALSGK 162

  Fly   157 --WLVFLCIFILLLITSPLW---VHQQILPLHAAFPFQWHEKSIHPISHAFIYLFQTWNVMYFLT 216
              |.::..........|..|   :::..|.|.|.  .|.....|:|:                  
  Fly   163 LPWRIYNPFVDFRESRSSFWKAALNETALMLFAV--TQTLMSDIYPL------------------ 207

  Fly   217 WLVCIEGLSVSIYVE-ITFAIEVLCLELRHLHQRCHGYEQLRLETN--RLVQFHQKIVHILDHTN 278
                :.||.:.:::: :...:|.||.:        .|......|.:  :.::.|..|:.......
  Fly   208 ----LYGLILRVHLKLLRLRVESLCTD--------SGKSDAENEQDLIKCIKDHNLIIDYAAAIR 260

  Fly   279 KVFHGTLIMQ---MGVNFFLVSLSVLEAMEARKDPKVVAQFAVLMLLALGHLSMWSYFGDLLSQK 340
            .....|:.:|   :|:...|..:::|...:.......||....||:...    .:.:..|||.:.
  Fly   261 PAVTRTIFVQFLLIGICLGLSMINLLFFADIWTGLATVAYINGLMVQTF----PFCFVCDLLKKD 321

  Fly   341 SLTISEAAYEAYDPIKGSKDVYRDLCLIIRRGQEPLIMRA-SPFPSFNFINYSAILNQCYGILTF 404
            ...:..|.:.: :.|..|:.....|...::..|:.:...| |.||.....|.. :....:.::||
  Fly   322 CELLVSAIFHS-NWINSSRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIK-VAKLAFSVVTF 384

  Fly   405 L 405
            :
  Fly   385 V 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 57/352 (16%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 55/342 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465217
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.