DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or88a

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster


Alignment Length:222 Identity:50/222 - (22%)
Similarity:85/222 - (38%) Gaps:45/222 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 YFLTW---LVCIEGLSVSIYVEITFAIEV----LCLELRHLHQRCHG-------------YEQLR 257
            |.|.|   |:|.. ..||.:|.......|    |.:.|.||.::...             :..||
  Fly   193 YLLVWSFDLMCTT-CGVSFFVTFDNLFNVMQGHLVMHLGHLARQFSAIDPRQSLTDEKRFFVDLR 256

  Fly   258 LETNRLVQFHQKIVHILDHTNKVFHGTLIMQMGVN-----FFLVSLSVLEAMEARKDPKVVAQFA 317
            |    |||..|.:..:....|.:|....::...|.     |:|..||      ...|..::||:.
  Fly   257 L----LVQRQQLLNGLCRKYNDIFKVAFLVSNFVGAGSLCFYLFMLS------ETSDVLIIAQYI 311

  Fly   318 VLMLLALGHLSMWSYFGDLLSQKSLTISEAAYEAYDPIKGSKDVYRDLCLI----IRRGQEPLIM 378
            :..|:.:|........|..|.:.|..: |::..:.:...||:. ||...|:    .:|.|:   :
  Fly   312 LPTLVLVGFTFEICLRGTQLEKASEGL-ESSLRSQEWYLGSRR-YRKFYLLWTQYCQRTQQ---L 371

  Fly   379 RASPFPSFNFINYSAILNQCYGILTFL 405
            .|......|.::::.|:...|.:.|||
  Fly   372 GAFGLIQVNMVHFTEIMQLAYRLFTFL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 46/214 (21%)
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 46/214 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465392
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.