DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or85f

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster


Alignment Length:296 Identity:54/296 - (18%)
Similarity:124/296 - (41%) Gaps:52/296 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 DYRTAKRWYFTLAFFLASSWLVFLCIFILLLITSPLWVHQQILPLHAAFPFQWHEKSIHPISHAF 202
            |:...|.:.:.:..::.||.:|.:...|..:|.  .:.|.....:| .:|:..::....|:   :
  Fly   124 DHYWTKSFVYLVIIYIGSSIMVVIGPIITSIIA--YFTHNVFTYMH-CYPYFLYDPEKDPV---W 182

  Fly   203 IYLFQTWNVMYFLTWL----VCIEGLSVSIYVEITFAIEVLCLELRHLHQR-------------C 250
            ||:     .:|.|.||    :.|..:...|:: :.|.:::      :||.|             .
  Fly   183 IYI-----SIYALEWLHSTQMVISNIGADIWL-LYFQVQI------NLHFRGIIRSLADHKPSVK 235

  Fly   251 HGYEQLRLETNRLVQFHQKIVHIL---DHTNKVFHGTLIMQMGVNFFLVSLSVL--EAMEARKDP 310
            |..|..:.    :.:...|.||::   :..|.:|..:|::.:     |.:.:|:  .|:......
  Fly   236 HDQEDRKF----IAKIVDKQVHLVSLQNDLNGIFGKSLLLSL-----LTTAAVICTVAVYTLIQG 291

  Fly   311 KVVAQFAVLMLLALGHLSMW--SYFGDLLSQKSLTISEAAYEAYDPIKGSKDVYRDLCLIIRRGQ 373
            ..:..|..::.:....:.::  .|:|..:...|..::.|.|. :|....|....|.|.:||.|.|
  Fly   292 PTLEGFTYVIFIGTSVMQVYLVCYYGQQVLDLSGEVAHAVYN-HDFHDASIAYKRYLLIIIIRAQ 355

  Fly   374 EPLIMRASPFPSFNFINYSAILNQCYGILTFLLKTL 409
            :|:.:.|..:.|.:...:..:::..|.::|.|::.:
  Fly   356 QPVELNAMGYLSISLDTFKQLMSVSYRVITMLMQMI 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 51/284 (18%)
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 51/284 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465390
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.