DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or85d

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster


Alignment Length:440 Identity:89/440 - (20%)
Similarity:175/440 - (39%) Gaps:88/440 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VHRFVKFYIDGWKHFRDPTMESSYSAVYY-----------WREQMKAMFLYTTSKERQMPYRSSW 60
            :|.|:|                 |:.|:|           :.::.|.:.|:.|...:.:    :.
  Fly    21 LHSFLK-----------------YANVFYLSIGMMAYDHKYSQKWKEVLLHWTFIAQMV----NL 64

  Fly    61 HTLVIIQATVCFLTMCYGVTESLGDKVQMGRDIAFIIGFFYIA-FKIYYFQWYGDELDEVVEALE 124
            :|::|.:....||.:..|     .:.::...:::| |||..:. |||:........|.:||..||
  Fly    65 NTVLISELIYVFLAIGKG-----SNFLEATMNLSF-IGFVIVGDFKIWNISRQRKRLTQVVSRLE 123

  Fly   125 TFHP--WAQKGPGAV-----DYRTAKRWYFTLAFFLASSWLVFLCIFILLLITSPLWV----HQQ 178
            ..||  .||:.|..:     .|....::||.:...|..::.::..::.|:   ...|:    .::
  Fly   124 ELHPQGLAQQEPYNIGHHLSGYSRYSKFYFGMHMVLIWTYNLYWAVYYLV---CDFWLGMRQFER 185

  Fly   179 ILPLHAAFPFQWHEKSIHPISHAFIYLFQTWN-------------VMYFLTWLVCIEGLSVSIYV 230
            :||.:...|:.|..    ..|:.|:|:.|...             :|..|..||.:..:.:|.::
  Fly   186 MLPYYCWVPWDWST----GYSYYFMYISQNIGGQACLSGQLAADMLMCALVTLVVMHFIRLSAHI 246

  Fly   231 EITFAIEVLCLELRHLHQRCHGYEQLRLE-TNRLVQFHQKIVHILDHTNKVFHGTLIMQMGVNFF 294
            |              .|....|..|..|| ....|.:||.::|:....|::|..:|:.....:.|
  Fly   247 E--------------SHVAGIGSFQHDLEFLQATVAYHQSLIHLCQDINEIFGVSLLSNFVSSSF 297

  Fly   295 LVSLSVLEAMEARKDPKVVAQFAVLMLLALGHLSMWSYFGDLLSQKSLTISEAAYEAYDPIKGSK 359
            ::.....:.....|...:| ...:.:..|:..:.|.:.....|...|..|.:|.|. :|..:...
  Fly   298 IICFVGFQMTIGSKIDNLV-MLVLFLFCAMVQVFMIATHAQRLVDASEQIGQAVYN-HDWFRADL 360

  Fly   360 DVYRDLCLIIRRGQEPLIMRASPFPSFNFINYSAILNQCYGILTFLLKTL 409
            ...:.|.|||:|.|:|..::|:.|.:.:.:..|.:|...|.... ||:|:
  Fly   361 RYRKMLILIIKRAQQPSRLKATMFLNISLVTVSDLLQLSYKFFA-LLRTM 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 71/337 (21%)
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 71/339 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465388
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.