DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or85c

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_524280.2 Gene:Or85c / 41008 FlyBaseID:FBgn0037591 Length:389 Species:Drosophila melanogaster


Alignment Length:410 Identity:88/410 - (21%)
Similarity:161/410 - (39%) Gaps:72/410 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AMFLYTT---------SKERQMPYRSSWHTLVIIQATVCFLTMCYGVTESLGDKVQMGRDIAFII 97
            |:|.||:         |:.::   .|.|..|:.....:....:.:|....||.....|:.|..:.
  Fly     7 AVFFYTSVGIEPYTIDSRSKK---ASLWSHLLFWANVINLSVIVFGEILYLGVAYSDGKFIDAVT 68

  Fly    98 GFFYIAF------KIYYFQWYGDELDEVVEALETFHP--WAQKGPGAVD--YRTAKRWYFTLAF- 151
            ...||.|      |:::..|...:|.::|:.||..:|  .|::....:|  .|:..|...|.|. 
  Fly    69 VLSYIGFVIVGMSKMFFIWWKKTDLSDLVKELEHIYPNGKAEEEMYRLDRYLRSCSRISITYALL 133

  Fly   152 -------FLASSWLVFLCIFILLLITSPLWVHQQILPLHAAFPFQWHEKSIHPISHAFIYLFQTW 209
                   |...|.:.||....||.|.    |..|.||....||:.|||.             .|:
  Fly   134 YSVLIWTFNLFSIMQFLVYEKLLKIR----VVGQTLPYLMYFPWNWHEN-------------WTY 181

  Fly   210 NVMYFLTWLVCIEGLSVSIYVEITFAIEVLCL----ELRHLHQRCHGYEQLRLETN--------- 261
            .|:.|..........|..|..::     :||.    .:.|........|:..|:.:         
  Fly   182 YVLLFCQNFAGHTSASGQISTDL-----LLCAVATQVVMHFDYLARVVEKQVLDRDWSENSRFLA 241

  Fly   262 RLVQFHQKIVHILDHTNKVFHGTLIMQMGVNFFLVSLSVLEAMEARKDPKVVAQFAVLMLLALGH 326
            :.||:||:|:.::|..|.:|...|::...|:.|::.....: |.....|.::.:..:.:..:|..
  Fly   242 KTVQYHQRILRLMDVLNDIFGIPLLLNFMVSTFVICFVGFQ-MTVGVPPDIMIKLFLFLFSSLSQ 305

  Fly   327 LSMWSYFGDLLSQKSLTISEAAYEAYDPIKGSKDV--YRDLCLIIRRGQEPLIMRASPFPSFNFI 389
            :.:..::|.|::..|.::|.:||:..   ..:.|:  .|.|...|.|.|....::|:.|.:....
  Fly   306 VYLICHYGQLIADASSSLSISAYKQN---WQNADIRYRRALVFFIARPQRTTYLKATIFMNITRA 367

  Fly   390 NYSAILNQCYGILTFLLKTL 409
            ..:.:|...|.... ||:|:
  Fly   368 TMTDLLQVSYKFFA-LLRTM 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 73/344 (21%)
Or85cNP_524280.2 7tm_6 63..377 CDD:251636 72/339 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465387
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.