DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or83c

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_524244.2 Gene:Or83c / 40744 FlyBaseID:FBgn0037399 Length:397 Species:Drosophila melanogaster


Alignment Length:294 Identity:50/294 - (17%)
Similarity:109/294 - (37%) Gaps:87/294 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 LASSWLVFLCIFILLLITSPLWVHQQILPLHAAFPFQWHEKSIHPISHAFIYLFQTWNVMYFL-T 216
            :.:.::...|:..||.:...::...::..:....|..       |:.:.:.|:     |.|.: |
  Fly   134 IRNGYVFAFCLMELLPLAMLMYDGTRVTAMQYLIPGL-------PLENNYCYV-----VTYMIQT 186

  Fly   217 WLVCIEGL---SVSIYV------EITFA--IEVLCLELRH-LHQRCHGYEQLRL------ETNR- 262
            ..:.::|:   |..::|      .:|||  ::|...||.. |.|:......:|:      ..|| 
  Fly   187 VTMLVQGVGFYSGDLFVFLGLTQILTFADMLQVKVKELNDALEQKAEYRALVRVGASIDGAENRQ 251

  Fly   263 -----LVQFHQKIVHILDHTNKVFH---GTLIMQMGVNF---FLVSLSVLEAMEARKDPKVVAQF 316
                 ::::||.........|.:::   .|.::.|.:..   |.::||......           
  Fly   252 RLLLDVIRWHQLFTDYCRAINALYYELIATQVLSMALAMMLSFCINLSSFHMPS----------- 305

  Fly   317 AVLMLLALGHLSMWSYFGDLLSQKSLTISEAAYEAYDPIKGSKDVYRDLCLII-------RRGQE 374
            |:..:::...:|::...|        ||.|.||:         .||..:|.:.       :|...
  Fly   306 AIFFVVSAYSMSIYCILG--------TILEFAYD---------QVYESICNVTWYELSGEQRKLF 353

  Fly   375 PLIMRASPFPSFNFINYSAILNQCYGILTFLLKT 408
            ..::|.|.:| .|.        |..|:::..::|
  Fly   354 GFLLRESQYP-HNI--------QILGVMSLSVRT 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 48/283 (17%)
Or83cNP_524244.2 7tm_6 69..387 CDD:251636 50/294 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465038
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.