DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or83a

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:375 Identity:70/375 - (18%)
Similarity:132/375 - (35%) Gaps:78/375 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 IAFIIGFFYIAFKIYYFQWYGDELDEVVEALETFHPWAQKGPG------AVDYRTAKRWYFTLAF 151
            |..||..:.||.|:|:.::....|:.::..:...:. .:...|      |..||.:|.|..|..:
  Fly    92 IQTIIYLWTIAMKLYFRRFRPGLLNTILSNINDEYE-TRSAVGFSFVTMAGSYRMSKLWIKTYVY 155

  Fly   152 FLASSWLVFLCIFI--LLLITSPLWVHQQILPLHAAFPFQWHEKSIHPISHAFIYLFQTWNVMYF 214
                      |.:|  :..:..|:....:.|||...:||.:.:..::.:    ::|.|....:..
  Fly   156 ----------CCYIGTIFWLALPIAYRDRSLPLACWYPFDYTQPGVYEV----VFLLQAMGQIQV 206

  Fly   215 LTWLVCIEGLSVSIYVEITFAIEVLCLELRHL-----------------------------HQRC 250
            ........||.:.:.|.|:...:||...|:::                             .|..
  Fly   207 AASFASSSGLHMVLCVLISGQYDVLFCSLKNVLASSYVLMGANMTELNQLQAEQSAADVEPGQYA 271

  Fly   251 HGYEQ-------------------LRLETNRLVQFHQKIVHILDHTNKVFHGTLIMQMGVNFFLV 296
            :..|:                   .||...|.:|.|:.||..|......:.....:::|...||:
  Fly   272 YSVEEETPLQELLKVGSSMDFSSAFRLSFVRCIQHHRYIVAALKKIESFYSPIWFVKIGEVTFLM 336

  Fly   297 SLSVL---EAMEARKDPKVVAQFAVLMLLALGHLSMWSYFGDLLSQKSLTISEAAYEAYDP-IKG 357
            .|...   ::..|....::|: ....:||.|..|.:..||.|::.|.|....||.:.:  | .:.
  Fly   337 CLVAFVSTKSTAANSFMRMVS-LGQYLLLVLYELFIICYFADIVFQNSQRCGEALWRS--PWQRH 398

  Fly   358 SKDVYRDLCLIIRRGQEPLIMRASPFPSFNFINYSAILNQCYGILTFLLK 407
            .|||..|....:...:....:.|....:.|...:...:...:..||.|.|
  Fly   399 LKDVRSDYMFFMLNSRRQFQLTAGKISNLNVDRFRGTITTAFSFLTLLQK 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 66/365 (18%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 51/301 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.