DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or71a

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster


Alignment Length:404 Identity:67/404 - (16%)
Similarity:146/404 - (36%) Gaps:79/404 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YWREQMKAMFLYTTSKERQMPYRSSWHTLVI---------------------IQATVCFLTMCYG 78
            :||       |:...:....|..::|....:                     ||.|...|.:|. 
  Fly    18 WWR-------LWPRKESVSTPDWTNWQAYALHVPFTFLFVLLLWLEAIKSRDIQHTADVLLICL- 74

  Fly    79 VTESLGDKVQMGRDIAFIIGFFYIAFKIYYFQW-YGDELDEVVEALETFHPWAQKGPGAVDYRTA 142
            .|.:||.||                ..|    | |......::....|:..:..:....||    
  Fly    75 TTTALGGKV----------------INI----WKYAHVAQGILSEWSTWDLFELRSKQEVD---- 115

  Fly   143 KRWYFTLAFFLASSWLVFLCI----FILLLITSPLWVHQQILPLHAAFPFQWHEKSIHPISHAFI 203
             .|.|....|  :...:|.|:    .|..::..||:.....||.....||.|.:    |:...:.
  Fly   116 -MWRFEHRRF--NRVFMFYCLCSAGVIPFIVIQPLFDIPNRLPFWMWTPFDWQQ----PVLFWYA 173

  Fly   204 YLFQTWNVMYFLTWLVCIEGLSVSIYVEITFAIEVLCLELRHLHQRCHGYEQLRLETNRLVQFHQ 268
            :::|...:.......|.::.::..:.:.::..:.:|...|..|.   |..:.||.:...|:..||
  Fly   174 FIYQATTIPIACACNVTMDAVNWYLMLHLSLCLRMLGQRLSKLQ---HDDKDLREKFLELIHLHQ 235

  Fly   269 KI------VHILDHTNKVFHGTLIMQMGVNFFLVSLSVLEAMEARKDPKVVAQFAVLMLLALGHL 327
            ::      :.|. .:...|...|:..:.:.|.:.|:.:...::.......:.|:.|.|::   .:
  Fly   236 RLKQQALSIEIF-ISKSTFTQILVSSLIICFTIYSMQMSPVLQDLPGFAAMMQYLVAMIM---QV 296

  Fly   328 SMWSYFGDLLSQKSLTISEAAYEAYDPIKGSKDVYRDLCLIIRRGQEPLIMRASPFPSFNFINYS 392
            .:.:.:|:.:...:..::::.|.:..|....: :.|.:.:.:.....|:.::|..|.......::
  Fly   297 MLPTIYGNAVIDSANMLTDSMYNSDWPDMNCR-MRRLVLMFMVYLNRPVTLKAGGFFHIGLPLFT 360

  Fly   393 AILNQCYGILTFLL 406
            ..:||.|.:|..||
  Fly   361 KTMNQAYSLLALLL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 49/322 (15%)
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 55/338 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465461
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.