DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or67b

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster


Alignment Length:265 Identity:49/265 - (18%)
Similarity:102/265 - (38%) Gaps:64/265 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 IAFIIGFFYIAF------------------KIYYFQWYGDELDEVVEALETFHPWAQKGPGAVDY 139
            :|||:..:.|:|                  |:::||...:...::|.:.||.......|...:|.
  Fly    63 VAFIMENYMISFETYVEAVLLTFQLSVGVVKMFHFQNKVESCSQLVFSTETGEVLKSLGLFQLDL 127

  Fly   140 RTAKRWYFTLAFFLASSWLV----------FLCIFILLLITSPLWVH--------QQILPLHAAF 186
            ...|....:::..|.::|::          .:|:.:|.....|.:.:        :....:...:
  Fly   128 PRKKELLSSVSLILLNNWMIIDRQVMFFFKIVCMPVLYYCVRPYFQYIFDCYIKDKDTCEMTLTY 192

  Fly   187 PFQWHEKSIHPISHAFIYLFQTWNVMYFL-----TW-LVCIEGLSVSIYVEITFAIEVLCLELRH 245
            |      :|.|......|.|.::.:.:||     .| ...:.|.: |::|.:|.....|...||.
  Fly   193 P------AIVPYLQLGNYEFPSYVIRFFLLQSGPLWCFFAVFGFN-SLFVVLTRYESGLIKVLRF 250

  Fly   246 LHQRCHGYEQLRLETNRLVQFHQKIV----HILDHTNKV---FHGTLIMQMGVNFFLVSL----- 298
            |.|  :....:.:..::.|::.|..|    .|..|.|::   |...:::|..|:..|:.:     
  Fly   251 LVQ--NSTSDILVPKDQRVKYLQCCVRLFARISSHHNQIENLFKYIILVQCSVSSILICMLLYKI 313

  Fly   299 -SVLE 302
             :|||
  Fly   314 STVLE 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 49/265 (18%)
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636 28/125 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435233
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.