DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or63a

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster


Alignment Length:359 Identity:74/359 - (20%)
Similarity:139/359 - (38%) Gaps:65/359 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 WHTLVIIQATVCFLTMCYGVTESLG----DKVQMGRDIAFIIGFFYIAFKIYYF-----QWYGDE 115
            | |:|:   :|..|...||..:.|.    |..::|......:.|.....|::||     |.|  |
  Fly    45 W-TIVL---SVSSLASLYGHWQMLARYIHDIPRIGETAGTALQFLTSIAKMWYFLFAHRQIY--E 103

  Fly   116 L------DEVVEALETFH-----PWAQKGPGAVDYRTAKRWYFT---LAFFLASSWLV----FLC 162
            |      .|:::..|.|.     |..::....|:....:.|..|   :..:|.|...:    |:.
  Fly   104 LLRKARCHELLQKCELFERMSDLPVIKEIRQQVESTMNRYWASTRRQILIYLYSCICITTNYFIN 168

  Fly   163 IFILLL---ITSPLWVHQQILPLHAAFPFQWHEKSIH-PISHAFIYLFQTWNVMYFLTWLVCIEG 223
            .|::.|   .|.|...:..:|||.:.:| .|..|.:. |..|..:|| :|.::.......|..:|
  Fly   169 SFVINLYRYFTKPKGSYDIMLPLPSLYP-AWEHKGLEFPYYHIQMYL-ETCSLYICGMCAVSFDG 231

  Fly   224 LSVSIYVEITFAIEVLCLE----LRHLHQRCHGYEQLRLETNRLVQF-------HQKIVHILDHT 277
            :.:           ||||.    :|.|:|.........:..:|.|::       :|::.:.....
  Fly   232 VFI-----------VLCLHSVGLMRSLNQMVEQATSELVPPDRRVEYLRCCIYQYQRVANFATEV 285

  Fly   278 NKVFHGTLIMQMGVNFFLVSLSVLEAMEARKDPKVVAQFAVLM-LLALGH-LSMWSYFGDLLSQK 340
            |..|......|..::.|...|::.:......:...:....:.| |:|.|: :.::.|.|...:..
  Fly   286 NNCFRHITFTQFLLSLFNWGLALFQMSVGLGNNSSITMIRMTMYLVAAGYQIVVYCYNGQRFATA 350

  Fly   341 SLTISEAAYEA--YDPIKGSKDVYRDLCLIIRRG 372
            |..|:.|.|:.  |...:..:.:.|.:.:...||
  Fly   351 SEEIANAFYQVRWYGESREFRHLIRMMLMRTNRG 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 65/328 (20%)
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 64/324 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435221
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.